Lineage for d5ibtl1 (5ibt L:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (193 PDB entries)
  8. 2347480Domain d5ibtl1: 5ibt L:1-107 [324941]
    Other proteins in same PDB: d5ibtl2
    automated match to d1dn0a1
    complexed with gol

Details for d5ibtl1

PDB Entry: 5ibt (more details), 2.4 Å

PDB Description: uca fab (unbound) from 6515 lineage
PDB Compounds: (L:) UCA light chain

SCOPe Domain Sequences for d5ibtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibtl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspwtfgqgtkvei

SCOPe Domain Coordinates for d5ibtl1:

Click to download the PDB-style file with coordinates for d5ibtl1.
(The format of our PDB-style files is described here.)

Timeline for d5ibtl1: