Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [272003] (3 PDB entries) |
Domain d5ehmb_: 5ehm B: [324940] automated match to d4mf3a_ complexed with oem |
PDB Entry: 5ehm (more details), 1.28 Å
SCOPe Domain Sequences for d5ehmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehmb_ c.94.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ktlvvttilsnpycmrkesaiplsgndqfegyavdliheiskslgfnykiqlvpdgsygs lnkltgewngmirelleqradlaiadltitfereqavdfttpfmnlgvsilyrkgtpies aedlakqtrikygalkggstaaffrdskistyqrmwsfmesarpsvftasngegvervak gkgsyaflmestsieyvternceltqvggmldtksygiatppnspyrtainsvilklqee gklhilktkwwkekrgg
Timeline for d5ehmb_: