| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries) |
| Domain d5glub2: 5glu B:145-278 [324932] Other proteins in same PDB: d5glua3, d5glub3 automated match to d4hl0a2 |
PDB Entry: 5glu (more details), 2.1 Å
SCOPe Domain Sequences for d5glub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5glub2 b.29.1.0 (B:145-278) automated matches {Toxascaris leonina [TaxId: 59264]}
yypvpyesglagdglapgksllifatpekkgkrfhinllkkngdialhfnprfdekaivr
nslisgewgneeregknplekgigcdlefrneeyafqiyvdgerfatyahrldphdingl
qiggdvevtgiqmv
Timeline for d5glub2: