SCOPe 2.01: Domain d1c3la_: 1c3l A:

Lineage for d1c3la_ (1c3l A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein Subtilisin [52745] (6 species)

7. Species Bacillus licheniformis [TaxId:1402] [52748] (15 PDB entries)

8. Domain d1c3la_: 1c3l A: [32492]
   complexed with ca, fmt, xe

Details for d1c3la_

PDB Entry: 1c3l, 2.16 Å

PDB Description: subtilisin-carlsberg complexed with xenon (8 bar)

PDB Compounds: (A:) subtilisin-carlsberg

SCOPe Domain Sequences for d1c3la_:

Sequence; same for both SEQRES and ATOM records:

>d1c3la_ c.41.1.1 (A:) Subtilisin {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgstntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

Timeline for d1c3la_:

• d1c3la_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3la_ appears in SCOP 1.75
  
• d1c3la_ appears in SCOPe 2.02
  
• d1c3la_ appears in the current release, SCOPe 2.08