Lineage for d1c3la_ (1c3l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115024Protein Subtilisin [52745] (7 species)
  7. 2115099Species Bacillus licheniformis [TaxId:1402] [52748] (18 PDB entries)
  8. 2115106Domain d1c3la_: 1c3l A: [32492]
    complexed with ca, fmt, xe

Details for d1c3la_

PDB Entry: 1c3l (more details), 2.16 Å

PDB Description: subtilisin-carlsberg complexed with xenon (8 bar)
PDB Compounds: (A:) subtilisin-carlsberg

SCOPe Domain Sequences for d1c3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3la_ c.41.1.1 (A:) Subtilisin {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgstntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d1c3la_:

Click to download the PDB-style file with coordinates for d1c3la_.
(The format of our PDB-style files is described here.)

Timeline for d1c3la_: