Lineage for d5gt4a_ (5gt4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336100Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 2336118Domain d5gt4a_: 5gt4 A: [324905]
    automated match to d1ie9a_
    complexed with 2kb

Details for d5gt4a_

PDB Entry: 5gt4 (more details), 1.83 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with (1r,2s,3r,5z,7e,14beta,17alpha)-2-cyanopropoxy- 9,10-secocholesta-5,7,10-triene-1,3,25-triol
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5gt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gt4a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

SCOPe Domain Coordinates for d5gt4a_:

Click to download the PDB-style file with coordinates for d5gt4a_.
(The format of our PDB-style files is described here.)

Timeline for d5gt4a_: