Lineage for d5ehsa_ (5ehs A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163739Species Drosophila grimshawi [TaxId:7222] [324895] (1 PDB entry)
  8. 2163740Domain d5ehsa_: 5ehs A: [324900]
    automated match to d4mf3a_
    complexed with 2jj, 5oy

Details for d5ehsa_

PDB Entry: 5ehs (more details), 1.75 Å

PDB Description: crystal structure of the drosophila cg3822 kair1d ligand binding domain complex with d-ap5
PDB Compounds: (A:) RE06730p,GH17276

SCOPe Domain Sequences for d5ehsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehsa_ c.94.1.0 (A:) automated matches {Drosophila grimshawi [TaxId: 7222]}
lknktlvvttilsnpycmrkesaiplsgndqfegyavdliheiskslgfnykiqlvpdgs
ygslnkltgewngmirelleqradlaiadltitfereqavdfttpfmnlgvsilyrkgtp
iesaedlakqtrikygalkggstaaffrdskistyqrmwsfmesarpsvftasngegver
vakgkgsyaflmestsieyvternceltqvggmldtksygiatppnspyrtainsvilkl
qeegklhilktkwwkekrgg

SCOPe Domain Coordinates for d5ehsa_:

Click to download the PDB-style file with coordinates for d5ehsa_.
(The format of our PDB-style files is described here.)

Timeline for d5ehsa_: