SCOPe 2.06: Domain d5ehsb_: 5ehs B:

Lineage for d5ehsb_ (5ehs B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Drosophila grimshawi [TaxId:7222] [324895] (1 PDB entry)

8. Domain d5ehsb_: 5ehs B: [324896]
   automated match to d4mf3a_
   complexed with 2jj, 5oy

Details for d5ehsb_

PDB Entry: 5ehs, 1.75 Å

PDB Description: crystal structure of the drosophila cg3822 kair1d ligand binding domain complex with d-ap5

PDB Compounds: (B:) RE06730p,GH17276

SCOPe Domain Sequences for d5ehsb_:

Sequence; same for both SEQRES and ATOM records:

>d5ehsb_ c.94.1.0 (B:) automated matches {Drosophila grimshawi [TaxId: 7222]}
lknktlvvttilsnpycmrkesaiplsgndqfegyavdliheiskslgfnykiqlvpdgs
ygslnkltgewngmirelleqradlaiadltitfereqavdfttpfmnlgvsilyrkgtp
iesaedlakqtrikygalkggstaaffrdskistyqrmwsfmesarpsvftasngegver
vakgkgsyaflmestsieyvternceltqvggmldtksygiatppnspyrtainsvilkl
qeegklhilktkwwkekr

Timeline for d5ehsb_:

• d5ehsb_ is new in SCOPe 2.06-stable
  
• d5ehsb_ appears in SCOPe 2.07
  
• d5ehsb_ appears in the current release, SCOPe 2.08