SCOPe 2.08: Domain d5fuba1: 5fub A:73-408

Lineage for d5fuba1 (5fub A:73-408)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [324889] (2 PDB entries)

8. Domain d5fuba1: 5fub A:73-408 [324890]
   Other proteins in same PDB: d5fuba2
   automated match to d4c03a_
   complexed with cl, edo, mes, na, sah

Details for d5fuba1

PDB Entry: 5fub, 2 Å

PDB Description: crystal structure of zebrafish protein arginine methyltransferase 2 catalytic domain with sah

PDB Compounds: (A:) protein arginine methyltransferase 2

SCOPe Domain Sequences for d5fuba1:

Sequence; same for both SEQRES and ATOM records:

>d5fuba1 c.66.1.0 (A:73-408) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
dawqddeyfgnygtlrlhlemlsdkprtetyrqvilsnsaalrekvvldlgcgtgvislf
callakpagvyaveassmaehteelvkqngcdgvvtvfqeraenltlptkvdvlvsewmg
ncllfeymlesvllardrwlkkggmmwpssacltivpcqafsdyrqkvefwenpyglnfs
ylqslaqkeflskpkfshhlqpedclstpadvitldmvtiqvsdlerlkgeftftveksg
mfhgftvwfsahfqcleedgpsielntgpyseithwkqtlfmldapvsveegdiiagsir
lqrnpiwrrhlsitflwninstevstvktkcfpmwr

Timeline for d5fuba1:

• d5fuba1 first appeared in SCOPe 2.06
  
• d5fuba1 appears in SCOPe 2.07