![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries) |
![]() | Domain d5glta1: 5glt A:2-144 [324874] Other proteins in same PDB: d5glta3, d5gltb3 automated match to d4hl0a1 |
PDB Entry: 5glt (more details), 2 Å
SCOPe Domain Sequences for d5glta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5glta1 b.29.1.0 (A:2-144) automated matches {Toxascaris leonina [TaxId: 59264]} atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp lssvthfsvdgdilityihwggk
Timeline for d5glta1: