SCOPe 2.06: Domain d5glwa1: 5glw A:2-144

Lineage for d5glwa1 (5glw A:2-144)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)

8. Domain d5glwa1: 5glw A:2-144 [324872]
   Other proteins in same PDB: d5glwa3, d5glwb3
   automated match to d4hl0a1
   complexed with gal, nag

Details for d5glwa1

PDB Entry: 5glw, 2 Å

PDB Description: tl-gal with lacnac

PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5glwa1:

Sequence; same for both SEQRES and ATOM records:

>d5glwa1 b.29.1.0 (A:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}
atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr
fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp
lssvthfsvdgdilityihwggk

Timeline for d5glwa1:

• d5glwa1 is new in SCOPe 2.06-stable
  
• d5glwa1 appears in SCOPe 2.07
  
• d5glwa1 appears in the current release, SCOPe 2.08