Lineage for d1bh6a_ (1bh6 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23787Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 23788Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 23789Family c.41.1.1: Subtilases [52744] (7 proteins)
  6. 23809Protein Subtilisin [52745] (6 species)
  7. 23851Species Bacillus licheniformis [TaxId:1402] [52748] (15 PDB entries)
  8. 23852Domain d1bh6a_: 1bh6 A: [32487]

Details for d1bh6a_

PDB Entry: 1bh6 (more details), 1.75 Å

PDB Description: subtilisin dy in complex with the synthetic inhibitor n-benzyloxycarbonyl-ala-pro-phe-chloromethyl ketone

SCOP Domain Sequences for d1bh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh6a_ c.41.1.1 (A:) Subtilisin {Bacillus licheniformis}
aqtvpygiplikadkvqaqgykganvkvgiidtgiasshtdlkvvggasfvsgesyntdg
nghgthvagtvaaldnttgvlgvapnvslyaikvlnssgsgsysaivsgiewatqngldv
inmslggpsgstalkqavdkayasgivvvaaagnsgnsgsqntigypakydsviavgavd
snknrasfssvgselevmapgvsvystypsntytslngtsmasphvagaaalilskyptl
sasqvrnrlsstatnlgdsfyygkglinveaaaq

SCOP Domain Coordinates for d1bh6a_:

Click to download the PDB-style file with coordinates for d1bh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh6a_: