Lineage for d1scja_ (1scj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115024Protein Subtilisin [52745] (7 species)
  7. 2115127Species Bacillus subtilis, E [TaxId:1423] [52747] (1 PDB entry)
  8. 2115128Domain d1scja_: 1scj A: [32486]
    Other proteins in same PDB: d1scjb_
    propeptide complex
    complexed with ca

Details for d1scja_

PDB Entry: 1scj (more details), 2 Å

PDB Description: crystal structure of subtilisin-propeptide complex
PDB Compounds: (A:) subtilisin e

SCOPe Domain Sequences for d1scja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scja_ c.41.1.1 (A:) Subtilisin {Bacillus subtilis, E [TaxId: 1423]}
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvspsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
wtnaqvrdrlestatylgnsfyygkglinvqaaaq

SCOPe Domain Coordinates for d1scja_:

Click to download the PDB-style file with coordinates for d1scja_.
(The format of our PDB-style files is described here.)

Timeline for d1scja_: