Lineage for d5knde3 (5knd E:352-455)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002956Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2002957Protein automated matches [254528] (11 species)
    not a true protein
  7. 2003033Species Enterococcus hirae [TaxId:768486] [324662] (2 PDB entries)
  8. 2003035Domain d5knde3: 5knd E:352-455 [324839]
    Other proteins in same PDB: d5kndd1, d5kndd2, d5knde1, d5knde2, d5kndf1, d5kndf2, d5kndg_
    automated match to d3vr2d3
    complexed with b3p, gol, mg, po4

Details for d5knde3

PDB Entry: 5knd (more details), 2.89 Å

PDB Description: crystal structure of the pi-bound v1 complex
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5knde3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5knde3 a.69.1.0 (E:352-455) automated matches {Enterococcus hirae [TaxId: 768486]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

SCOPe Domain Coordinates for d5knde3:

Click to download the PDB-style file with coordinates for d5knde3.
(The format of our PDB-style files is described here.)

Timeline for d5knde3: