SCOPe 2.06: Domain d5ecqb2: 5ecq B:84-217

Lineage for d5ecqb2 (5ecq B:84-217)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [324612] (13 PDB entries)

8. Domain d5ecqb2: 5ecq B:84-217 [324816]
   Other proteins in same PDB: d5ecqb1, d5ecqc1, d5ecqe1, d5ecqf1
   automated match to d2vo4a2
   complexed with atp, gsh, jaa, val

Details for d5ecqb2

PDB Entry: 5ecq, 1.66 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, val and atp

PDB Compounds: (B:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecqb2:

Sequence; same for both SEQRES and ATOM records:

>d5ecqb2 a.45.1.0 (B:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

Timeline for d5ecqb2:

• d5ecqb2 is new in SCOPe 2.06-stable
  
• d5ecqb2 appears in SCOPe 2.07
  
• d5ecqb2 appears in the current release, SCOPe 2.08