| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries) |
| Domain d5ecnf2: 5ecn F:84-217 [324813] Other proteins in same PDB: d5ecnb1, d5ecnc1, d5ecne1, d5ecnf1 automated match to d2vo4a2 complexed with atp, gsh, jaa, leu |
PDB Entry: 5ecn (more details), 1.72 Å
SCOPe Domain Sequences for d5ecnf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecnf2 a.45.1.0 (F:84-217) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl
Timeline for d5ecnf2: