![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (11 species) not a true protein |
![]() | Species Enterococcus hirae [TaxId:768486] [324662] (2 PDB entries) |
![]() | Domain d5kndd3: 5knd D:352-455 [324809] Other proteins in same PDB: d5kndd1, d5kndd2, d5knde1, d5knde2, d5kndf1, d5kndf2, d5kndg_ automated match to d3vr2d3 complexed with b3p, gol, mg, po4 |
PDB Entry: 5knd (more details), 2.89 Å
SCOPe Domain Sequences for d5kndd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kndd3 a.69.1.0 (D:352-455) automated matches {Enterococcus hirae [TaxId: 768486]} kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp
Timeline for d5kndd3: