![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Enterococcus hirae [TaxId:768486] [324660] (7 PDB entries) |
![]() | Domain d5kndd2: 5knd D:76-351 [324808] Other proteins in same PDB: d5kndd1, d5kndd3, d5knde1, d5knde3, d5kndf1, d5kndf3, d5kndg_ automated match to d3vr4d2 complexed with b3p, gol, mg, po4 |
PDB Entry: 5knd (more details), 2.89 Å
SCOPe Domain Sequences for d5kndd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kndd2 c.37.1.0 (D:76-351) automated matches {Enterococcus hirae [TaxId: 768486]} plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi pdltgyitegqiiltrelyksgiqppidvlpslsrl
Timeline for d5kndd2: