SCOPe 2.08: Domain d5ecif2: 5eci F:84-217

Lineage for d5ecif2 (5eci F:84-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)

8. Domain d5ecif2: 5eci F:84-217 [324804]
   Other proteins in same PDB: d5ecib1, d5ecic1, d5ecie1, d5ecif1
   automated match to d2vo4a2
   complexed with atp, gsh, jaa, mg

Details for d5ecif2

PDB Entry: 5eci, 1.56 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, atp and mg

PDB Compounds: (F:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecif2:

Sequence; same for both SEQRES and ATOM records:

>d5ecif2 a.45.1.0 (F:84-217) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

Timeline for d5ecif2:

• d5ecif2 first appeared in SCOPe 2.06
  
• d5ecif2 appears in SCOPe 2.07