Lineage for d1a2ob2 (1a2o B:141-347)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1366712Fold c.40: Methylesterase CheB, C-terminal domain [52737] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3421567
  4. 1366713Superfamily c.40.1: Methylesterase CheB, C-terminal domain [52738] (1 family) (S)
    automatically mapped to Pfam PF01339
  5. 1366714Family c.40.1.1: Methylesterase CheB, C-terminal domain [52739] (1 protein)
  6. 1366715Protein Methylesterase CheB, C-terminal domain [52740] (1 species)
  7. 1366716Species Salmonella typhimurium [TaxId:90371] [52741] (2 PDB entries)
  8. 1366719Domain d1a2ob2: 1a2o B:141-347 [32480]
    Other proteins in same PDB: d1a2oa1, d1a2ob1

Details for d1a2ob2

PDB Entry: 1a2o (more details), 2.4 Å

PDB Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain
PDB Compounds: (B:) cheb methylesterase

SCOPe Domain Sequences for d1a2ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ob2 c.40.1.1 (B:141-347) Methylesterase CheB, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
maapttlkagpllssekliaigastggteairhvlqplplsspaviitqhmppgftrsfa
erlnklcqisvkeaedgervlpghayiapgdkhmelarsganyqikihdgppvnrhrpsv
dvlfhsvakhagrnavgviltgmgndgaagmlamyqagawtiaqneascvvfgmpreain
mggvsevvdlsqvsqqmlakisagqai

SCOPe Domain Coordinates for d1a2ob2:

Click to download the PDB-style file with coordinates for d1a2ob2.
(The format of our PDB-style files is described here.)

Timeline for d1a2ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a2ob1