Lineage for d5tqja_ (5tqj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438754Species Burkholderia phymatum [TaxId:148447] [324792] (1 PDB entry)
  8. 2438755Domain d5tqja_: 5tqj A: [324793]
    automated match to d4q7ea_
    complexed with cl, edo

Details for d5tqja_

PDB Entry: 5tqj (more details), 1.3 Å

PDB Description: crystal structure of response regulator receiver protein from burkholderia phymatum
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d5tqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqja_ c.23.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 148447]}
kpfvvvvdddasvgrairrllrsvgiaadtytsgdefldvlsatpsyrpdcvildvqmpg
sngievqrrlaggavpvifitahddagvretalaagaraylrkpfndvlfirtvcavlgi
aapl

SCOPe Domain Coordinates for d5tqja_:

Click to download the PDB-style file with coordinates for d5tqja_.
(The format of our PDB-style files is described here.)

Timeline for d5tqja_: