Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries) |
Domain d5ecke2: 5eck E:84-217 [324787] Other proteins in same PDB: d5eckb1, d5eckc1, d5ecke1, d5eckf1 automated match to d2vo4a2 complexed with atp, gsh, ile, jaa |
PDB Entry: 5eck (more details), 1.54 Å
SCOPe Domain Sequences for d5ecke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecke2 a.45.1.0 (E:84-217) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse kivayaaeyrknnl
Timeline for d5ecke2: