SCOPe 2.08: Domain d4zjbg1: 4zjb G:1-76

Lineage for d4zjbg1 (4zjb G:1-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [324772] (3 PDB entries)

8. Domain d4zjbg1: 4zjb G:1-76 [324773]
   Other proteins in same PDB: d4zjba_, d4zjbb_, d4zjbg2
   automated match to d2cnra_
   complexed with cit, pns

Details for d4zjbg1

PDB Entry: 4zjb, 2.55 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) in complex with holo-acp from helicobacter pylori

PDB Compounds: (G:) Acyl carrier protein

SCOPe Domain Sequences for d4zjbg1:

Sequence; same for both SEQRES and ATOM records:

>d4zjbg1 a.28.1.0 (G:1-76) automated matches {Helicobacter pylori [TaxId: 210]}
malfediqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqae
kivnvgdvvkyiednk

Timeline for d4zjbg1:

• d4zjbg1 first appeared in SCOPe 2.06
  
• d4zjbg1 appears in SCOPe 2.07