Lineage for d1d0sa_ (1d0s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873232Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 2873233Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 2873234Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
    automatically mapped to Pfam PF02277
  6. 2873235Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 2873236Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)
  8. 2873256Domain d1d0sa_: 1d0s A: [32477]
    complexed with dmd, po4

Details for d1d0sa_

PDB Entry: 1d0s (more details), 1.9 Å

PDB Description: crystal structure of nicotinate mononucleotide : 5,6- dimethylbenzimidazole phosphoribosyltransferase (cobt) from salmonella typhimurium complexed with 5, 6-dimethylbenzimidazole
PDB Compounds: (A:) nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1d0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0sa_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsryacdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d1d0sa_:

Click to download the PDB-style file with coordinates for d1d0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1d0sa_: