Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein HCV helicase domain [52725] (1 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (17 PDB entries) |
Domain d1cu1b3: 1cu1 B:1326-1631 [32474] Other proteins in same PDB: d1cu1a1, d1cu1b1 complexed with po4, zn |
PDB Entry: 1cu1 (more details), 2.5 Å
SCOPe Domain Sequences for d1cu1b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu1b3 c.37.1.14 (B:1326-1631) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} pgsvtvphpnieevalsntgeipfygkaipieairggrhlifchskkkcdelaaklsglg inavayyrgldvsviptigdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft ietttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimacmsa dlevvt
Timeline for d1cu1b3: