Lineage for d5layb_ (5lay B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712529Domain d5layb_: 5lay B: [324733]
    automated match to d4ereb_
    complexed with 6ss, gol, so4

Details for d5layb_

PDB Entry: 5lay (more details), 2.71 Å

PDB Description: discovery of new natural-product-inspired spiro-oxindole compounds as orally active inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound 6g
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5layb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5layb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d5layb_:

Click to download the PDB-style file with coordinates for d5layb_.
(The format of our PDB-style files is described here.)

Timeline for d5layb_: