Lineage for d5ecta1 (5ect A:1-141)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2407003Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2407004Protein automated matches [191182] (16 species)
    not a true protein
  7. 2407170Species Mycobacterium tuberculosis [TaxId:1773] [324721] (1 PDB entry)
  8. 2407171Domain d5ecta1: 5ect A:1-141 [324722]
    Other proteins in same PDB: d5ecta2
    automated match to d1rnja_
    complexed with dup, gol, mg, trs; mutant

Details for d5ecta1

PDB Entry: 5ect (more details), 1.3 Å

PDB Description: mycobacterium tuberculosis dutpase g143stop mutant
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d5ecta1:

Sequence, based on SEQRES records: (download)

>d5ecta1 b.85.4.0 (A:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeaglastsrg

Sequence, based on observed residues (ATOM records): (download)

>d5ecta1 b.85.4.0 (A:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeatsrg

SCOPe Domain Coordinates for d5ecta1:

Click to download the PDB-style file with coordinates for d5ecta1.
(The format of our PDB-style files is described here.)

Timeline for d5ecta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ecta2