Lineage for d5sxoa2 (5sxo A:252-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917767Species Listeria monocytogenes [TaxId:176281] [324718] (1 PDB entry)
  8. 2917769Domain d5sxoa2: 5sxo A:252-411 [324720]
    automated match to d3o04a2

Details for d5sxoa2

PDB Entry: 5sxo (more details), 1.35 Å

PDB Description: 1.35 angstrom resolution crystal structure of beta-ketoacyl-acp synthase ii (fabf) from listeria monocytogenes
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d5sxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxoa2 c.95.1.0 (A:252-411) automated matches {Listeria monocytogenes [TaxId: 176281]}
kiyaeivgygatgdayhitapapngegaaramkmaiddagltpdkvdyinahgtstpynd
eyetqaiktvfgdhakklaisstksmtghtlgasggieaifalltirdniiaptihlknq
devcdldyvpneareanvnvvisnsfgfgghnatlvfkri

SCOPe Domain Coordinates for d5sxoa2:

Click to download the PDB-style file with coordinates for d5sxoa2.
(The format of our PDB-style files is described here.)

Timeline for d5sxoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sxoa1