Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Listeria monocytogenes [TaxId:176281] [324718] (1 PDB entry) |
Domain d5sxoa2: 5sxo A:252-411 [324720] automated match to d3o04a2 |
PDB Entry: 5sxo (more details), 1.35 Å
SCOPe Domain Sequences for d5sxoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sxoa2 c.95.1.0 (A:252-411) automated matches {Listeria monocytogenes [TaxId: 176281]} kiyaeivgygatgdayhitapapngegaaramkmaiddagltpdkvdyinahgtstpynd eyetqaiktvfgdhakklaisstksmtghtlgasggieaifalltirdniiaptihlknq devcdldyvpneareanvnvvisnsfgfgghnatlvfkri
Timeline for d5sxoa2: