Lineage for d5laza_ (5laz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998383Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1998384Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1998385Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1998542Protein automated matches [254465] (1 species)
    not a true protein
  7. 1998543Species Human (Homo sapiens) [TaxId:9606] [254996] (3 PDB entries)
  8. 1998545Domain d5laza_: 5laz A: [324717]
    automated match to d4ereb_
    complexed with 6st, so4, zn

Details for d5laza_

PDB Entry: 5laz (more details), 1.66 Å

PDB Description: novel spiro[3h-indole-3,2 -pyrrolidin]-2(1h)-one inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound bi-0252
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5laza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laza_ a.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d5laza_:

Click to download the PDB-style file with coordinates for d5laza_.
(The format of our PDB-style files is described here.)

Timeline for d5laza_: