![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (5 proteins) |
![]() | Protein automated matches [190366] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries) |
![]() | Domain d5ktwc1: 5ktw C:1085-1196 [324715] Other proteins in same PDB: d5ktwa2, d5ktwb2, d5ktwc2 automated match to d4nyxa_ complexed with 6xg, edo |
PDB Entry: 5ktw (more details), 1.09 Å
SCOPe Domain Sequences for d5ktwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ktwc1 a.29.2.1 (C:1085-1196) automated matches {Human (Homo sapiens) [TaxId: 9606]} fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal
Timeline for d5ktwc1:
![]() Domains from other chains: (mouse over for more information) d5ktwa1, d5ktwa2, d5ktwb1, d5ktwb2 |