Lineage for d5ktwc1 (5ktw C:1085-1196)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706704Domain d5ktwc1: 5ktw C:1085-1196 [324715]
    Other proteins in same PDB: d5ktwa2, d5ktwb2, d5ktwc2
    automated match to d4nyxa_
    complexed with 6xg, edo

Details for d5ktwc1

PDB Entry: 5ktw (more details), 1.09 Å

PDB Description: crebbp bromodomain in complex with cpd 44 (3-((5-acetyl-1- (cyclopropylmethyl)-4,5,6,7-tetrahydro-1h-pyrazolo[4,3-c]pyridin-3- yl)amino)-n-isopropylbenzamide)
PDB Compounds: (C:) creb-binding protein

SCOPe Domain Sequences for d5ktwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktwc1 a.29.2.1 (C:1085-1196) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal

SCOPe Domain Coordinates for d5ktwc1:

Click to download the PDB-style file with coordinates for d5ktwc1.
(The format of our PDB-style files is described here.)

Timeline for d5ktwc1: