Lineage for d5lawa_ (5law A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712543Protein automated matches [254465] (1 species)
    not a true protein
  7. 2712544Species Human (Homo sapiens) [TaxId:9606] [254996] (3 PDB entries)
  8. 2712545Domain d5lawa_: 5law A: [324711]
    automated match to d4ereb_
    complexed with 6sj, so4

Details for d5lawa_

PDB Entry: 5law (more details), 1.64 Å

PDB Description: novel spiro[3h-indole-3,2 -pyrrolidin]-2(1h)-one inhibitors of the mdm2-p53 interaction: hdm2 (mdm2) in complex with compound 14
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5lawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lawa_ a.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d5lawa_:

Click to download the PDB-style file with coordinates for d5lawa_.
(The format of our PDB-style files is described here.)

Timeline for d5lawa_: