Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.14: RNA helicase [52724] (1 protein) |
Protein HCV helicase domain [52725] (1 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (5 PDB entries) |
Domain d1cu1a2: 1cu1 A:187-325 [32471] Other proteins in same PDB: d1cu1a1, d1cu1b1 |
PDB Entry: 1cu1 (more details), 2.5 Å
SCOP Domain Sequences for d1cu1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu1a2 c.37.1.14 (A:187-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates} nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah gidpnirtgvrtittgapvtystygkfladggcsggaydiiicdechstdsttilgigtv ldqaetagarlvvlatatp
Timeline for d1cu1a2: