Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.20: V-type ATPase central rotor subunit D [310580] (2 families) Role similar to F1 ATP synthase gamma (c.49.2), but do not appear to be homologous Has 2 antiparallel beta strands in addition to coiled coils; see PubMed 25971514 |
Family h.4.20.0: automated matches [310670] (1 protein) not a true family |
Protein automated matches [310867] (3 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324701] (2 PDB entries) |
Domain d5kndg_: 5knd G: [324702] Other proteins in same PDB: d5kndd1, d5kndd2, d5kndd3, d5knde1, d5knde2, d5knde3, d5kndf1, d5kndf2, d5kndf3 automated match to d3a5cg_ complexed with b3p, gol, mg, po4 |
PDB Entry: 5knd (more details), 2.89 Å
SCOPe Domain Sequences for d5kndg_:
Sequence, based on SEQRES records: (download)
>d5kndg_ h.4.20.0 (G:) automated matches {Enterococcus hirae [TaxId: 768486]} nptrmeltrlkkqlttatrghkllkdkqdelmrqfillirknnelrqaieketqtamkdf vlakstveeafidellalpaenvsisvveknimsvkvplmnfqydetlnetpleygylhs naeldrsidgftqllpkllklaevektcqlmaeeiektrrrvnaleymtipqleetiyyi kmkleeneraevtrlikvknm
>d5kndg_ h.4.20.0 (G:) automated matches {Enterococcus hirae [TaxId: 768486]} nptrmeltrlkkqlttatrghkllkdkqdelmrqfillirknnelrqaieketqtamkdf vlakstveeafideenvsisvveknimsvkvplmnfqnaeldrsidgftqllpkllklae vektcqlmaeeiektrrrvnaleymtipqleetiyyikmkleeneraevtrlikvknm
Timeline for d5kndg_: