| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (61 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [324612] (13 PDB entries) |
| Domain d5ecpc2: 5ecp C:84-217 [324699] Other proteins in same PDB: d5ecpb1, d5ecpc1, d5ecpe1, d5ecpf1 automated match to d2vo4a2 complexed with atp, gsh, jaa, met |
PDB Entry: 5ecp (more details), 2.25 Å
SCOPe Domain Sequences for d5ecpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecpc2 a.45.1.0 (C:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl
Timeline for d5ecpc2: