SCOPe 2.08: Domain d8ohma1: 8ohm A:190-325

Lineage for d8ohma1 (8ohm A:190-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, N-terminal domain [418962] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)

8. Domain d8ohma1: 8ohm A:190-325 [32469]
   Other proteins in same PDB: d8ohma2

Details for d8ohma1

PDB Entry: 8ohm, 2.3 Å

PDB Description: crystal structure of rna helicase from genotype 1b hepatitis c virus: mechanism of unwinding duplex rna

PDB Compounds: (A:) RNA helicase

SCOPe Domain Sequences for d8ohma1:

Sequence; same for both SEQRES and ATOM records:

>d8ohma1 c.37.1.14 (A:190-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
ppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymskahgid
pnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigtvldq
aetagarlvvlatatp

Timeline for d8ohma1:

• d8ohma1 first appeared (with stable ids) in SCOP 1.55, called d8ohm_1
  
• d8ohma1 appears in SCOPe 2.07