Lineage for d5ecle1 (5ecl E:4-83)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (173 species)
    not a true protein
  7. 2458773Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (26 PDB entries)
  8. 2458814Domain d5ecle1: 5ecl E:4-83 [324689]
    Other proteins in same PDB: d5eclb2, d5eclc2, d5ecle2, d5eclf2
    automated match to d3fhsa3
    complexed with gsh, ile, jaa, mg

Details for d5ecle1

PDB Entry: 5ecl (more details), 1.85 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, ile and mg
PDB Compounds: (E:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecle1 c.47.1.0 (E:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
vceslnvvqyvdeawpeknp

SCOPe Domain Coordinates for d5ecle1:

Click to download the PDB-style file with coordinates for d5ecle1.
(The format of our PDB-style files is described here.)

Timeline for d5ecle1: