Lineage for d5kkcd1 (5kkc D:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2429510Protein automated matches [226881] (6 species)
    not a true protein
  7. 2429563Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries)
  8. 2429583Domain d5kkcd1: 5kkc D:1-159 [324680]
    Other proteins in same PDB: d5kkca2, d5kkcb2, d5kkcc2, d5kkcd2
    automated match to d4i9ha1
    complexed with 6v0, so4

Details for d5kkcd1

PDB Entry: 5kkc (more details), 1.86 Å

PDB Description: l-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5kkcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkcd1 c.2.1.5 (D:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5kkcd1:

Click to download the PDB-style file with coordinates for d5kkcd1.
(The format of our PDB-style files is described here.)

Timeline for d5kkcd1: