Lineage for d1a1va1 (1a1v A:190-325)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23751Family c.37.1.14: RNA helicase [52724] (1 protein)
  6. 23752Protein HCV helicase domain [52725] (1 species)
  7. 23753Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (4 PDB entries)
  8. 23754Domain d1a1va1: 1a1v A:190-325 [32467]

Details for d1a1va1

PDB Entry: 1a1v (more details), 2.2 Å

PDB Description: hepatitis c virus ns3 helicase domain complexed with single stranded sdna

SCOP Domain Sequences for d1a1va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd
pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq
aetagarlvvlatatp

SCOP Domain Coordinates for d1a1va1:

Click to download the PDB-style file with coordinates for d1a1va1.
(The format of our PDB-style files is described here.)

Timeline for d1a1va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a1va2