Lineage for d5kncf2 (5knc F:76-351)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871881Species Enterococcus hirae [TaxId:768486] [324660] (7 PDB entries)
  8. 2871890Domain d5kncf2: 5knc F:76-351 [324661]
    Other proteins in same PDB: d5kncd1, d5kncd3, d5knce1, d5knce3, d5kncf1, d5kncf3, d5kncg_
    automated match to d3vr4d2
    complexed with adp, gol, mg, so4

Details for d5kncf2

PDB Entry: 5knc (more details), 3.02 Å

PDB Description: crystal structure of the 3 adp-bound v1 complex
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5kncf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kncf2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 768486]}
plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai
dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm
edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae
alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi
pdltgyitegqiiltrelyksgiqppidvlpslsrl

SCOPe Domain Coordinates for d5kncf2:

Click to download the PDB-style file with coordinates for d5kncf2.
(The format of our PDB-style files is described here.)

Timeline for d5kncf2: