SCOPe 2.08: Domain d1heib2: 1hei B:326-628

Lineage for d1heib2 (1hei B:326-628)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, C-terminal domain [418963] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries)

8. Domain d1heib2: 1hei B:326-628 [32466]
   Other proteins in same PDB: d1heia1, d1heib1
   complexed with ca
   has additional subdomain(s) that are not in the common domain

Details for d1heib2

PDB Entry: 1hei, 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

PDB Compounds: (B:) hcv helicase

SCOPe Domain Sequences for d1heib2:

Sequence; same for both SEQRES and ATOM records:

>d1heib2 c.37.1.14 (B:326-628) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvshpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalg
inavayyrgldvsviptngdvvvvstdalmtgftgdfdsvidcntcvtqtvdfsldptft
ietttlpqdavsrtqrrgrtgrgkpgiyrfvapgerpsgmfdssvlcecydagcawyelm
paettvrlraymntpglpvcqdhlefwegvftglthidahflsqtkqsgenfpylvayqa
tvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevtlthpitkyimtcmsa
dle

Timeline for d1heib2:

• d1heib2 first appeared (with stable ids) in SCOP 1.55
  
• d1heib2 appears in SCOPe 2.07