Lineage for d5h03a2 (5h03 A:211-419)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606698Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)
  8. 2606704Domain d5h03a2: 5h03 A:211-419 [324656]
    automated match to d1giqa2

Details for d5h03a2

PDB Entry: 5h03 (more details), 1.89 Å

PDB Description: crystal structure of an adp-ribosylating toxin beca from c. perfringens
PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5h03a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h03a2 d.166.1.0 (A:211-419) automated matches {Clostridium perfringens [TaxId: 1502]}
qlnfendvisasqwgeenyapwlkeltsnelrdinnylgggytainkylldgtigentsk
edleekisnissalkkrkipediityrrmgpnefgldlnspdydfnkvenvskfkekwlg
ktipvktfisttvlsnnisafakrklilrlhlpngsnaayvsvaegykneyevlidhgys
ykidniteyydesslggktnkliidatli

SCOPe Domain Coordinates for d5h03a2:

Click to download the PDB-style file with coordinates for d5h03a2.
(The format of our PDB-style files is described here.)

Timeline for d5h03a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h03a1