SCOPe 2.07: Domain d5gqqd1: 5gqq D:24-188

Lineage for d5gqqd1 (5gqq D:24-188)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)

8. Domain d5gqqd1: 5gqq D:24-188 [324651]
   Other proteins in same PDB: d5gqqa_, d5gqqb_, d5gqqc2, d5gqqd2
   automated match to d3aaja_
   complexed with ca, cl

Details for d5gqqd1

PDB Entry: 5gqq, 2.2 Å

PDB Description: structure of alg-2/hebp2 complex

PDB Compounds: (D:) programmed cell death protein 6

SCOPe Domain Sequences for d5gqqd1:

Sequence; same for both SEQRES and ATOM records:

>d5gqqd1 a.39.1.0 (D:24-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf

Timeline for d5gqqd1:

• d5gqqd1 first appeared in SCOPe 2.06
  
• d5gqqd1 appears in the current release, SCOPe 2.08