| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) ![]() |
| Family d.60.1.0: automated matches [254313] (1 protein) not a true family |
| Protein automated matches [254719] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256053] (3 PDB entries) |
| Domain d5gqqa_: 5gqq A: [324650] Other proteins in same PDB: d5gqqc1, d5gqqc2, d5gqqd1, d5gqqd2 automated match to d3r8ja_ complexed with ca, cl |
PDB Entry: 5gqq (more details), 2.2 Å
SCOPe Domain Sequences for d5gqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gqqa_ d.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknek
emkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfv
rsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqk
Timeline for d5gqqa_: