Lineage for d5gqqa_ (5gqq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956515Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2956516Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2956552Family d.60.1.0: automated matches [254313] (1 protein)
    not a true family
  6. 2956553Protein automated matches [254719] (1 species)
    not a true protein
  7. 2956554Species Human (Homo sapiens) [TaxId:9606] [256053] (3 PDB entries)
  8. 2956557Domain d5gqqa_: 5gqq A: [324650]
    Other proteins in same PDB: d5gqqc1, d5gqqc2, d5gqqd1, d5gqqd2
    automated match to d3r8ja_
    complexed with ca, cl

Details for d5gqqa_

PDB Entry: 5gqq (more details), 2.2 Å

PDB Description: structure of alg-2/hebp2 complex
PDB Compounds: (A:) Heme-binding protein 2

SCOPe Domain Sequences for d5gqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gqqa_ d.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknek
emkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfv
rsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqk

SCOPe Domain Coordinates for d5gqqa_:

Click to download the PDB-style file with coordinates for d5gqqa_.
(The format of our PDB-style files is described here.)

Timeline for d5gqqa_: