![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
![]() | Domain d5gqqc1: 5gqq C:24-191 [324648] Other proteins in same PDB: d5gqqa_, d5gqqb_, d5gqqc2, d5gqqd2 automated match to d3aaja_ complexed with ca, cl |
PDB Entry: 5gqq (more details), 2.2 Å
SCOPe Domain Sequences for d5gqqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gqqc1 a.39.1.0 (C:24-191) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
Timeline for d5gqqc1:
![]() Domains from other chains: (mouse over for more information) d5gqqa_, d5gqqb_, d5gqqd1, d5gqqd2 |