| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
| Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
| Protein automated matches [226991] (9 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [324642] (4 PDB entries) |
| Domain d5hhtb3: 5hht B:528-663 [324643] Other proteins in same PDB: d5hhta1, d5hhta2, d5hhtb1, d5hhtb2, d5hhtb4 automated match to d2r8oa3 complexed with ca, edo, tdp |
PDB Entry: 5hht (more details), 1.5 Å
SCOPe Domain Sequences for d5hhtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hhtb3 c.48.1.0 (B:528-663) automated matches {Escherichia coli [TaxId: 83333]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell
Timeline for d5hhtb3: