SCOPe 2.07: Domain d5egga1: 5egg A:1-147

Lineage for d5egga1 (5egg A:1-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d5egga1: 5egg A:1-147 [324634]
   Other proteins in same PDB: d5egga2
   automated match to d2clwa_

Details for d5egga1

PDB Entry: 5egg, 1.76 Å

PDB Description: crystal structure of human ubiquitin-conjugating enzyme ubch5c

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d5egga1:

Sequence; same for both SEQRES and ATOM records:

>d5egga1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

Timeline for d5egga1:

• d5egga1 first appeared in SCOPe 2.06
  
• d5egga1 appears in the current release, SCOPe 2.08