SCOPe 2.08: Domain d1heia1: 1hei A:187-325

Lineage for d1heia1 (1hei A:187-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, N-terminal domain [418962] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)

8. Domain d1heia1: 1hei A:187-325 [32463]
   Other proteins in same PDB: d1heia2, d1heib2
   complexed with ca

Details for d1heia1

PDB Entry: 1hei, 2.1 Å

PDB Description: structure of the hepatitis c virus rna helicase domain

PDB Compounds: (A:) hcv helicase

SCOPe Domain Sequences for d1heia1:

Sequence; same for both SEQRES and ATOM records:

>d1heia1 c.37.1.14 (A:187-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtv
ldqaetagarlvvlatatp

Timeline for d1heia1:

• d1heia1 first appeared (with stable ids) in SCOP 1.55
  
• d1heia1 appears in SCOPe 2.07