Lineage for d5edda1 (5edd A:1-133)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2406809Family b.85.4.1: dUTPase-like [51284] (5 protein domains)
  6. 2406963Protein automated matches [190798] (8 species)
    not a true protein
  7. 2406984Species Mycobacterium tuberculosis [TaxId:1773] [189128] (6 PDB entries)
  8. 2406990Domain d5edda1: 5edd A:1-133 [324628]
    Other proteins in same PDB: d5edda2
    automated match to d1sjnb_
    complexed with dup, mg, trs; mutant

Details for d5edda1

PDB Entry: 5edd (more details), 1.97 Å

PDB Description: crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d5edda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5edda1 b.85.4.1 (A:1-133) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdea

SCOPe Domain Coordinates for d5edda1:

Click to download the PDB-style file with coordinates for d5edda1.
(The format of our PDB-style files is described here.)

Timeline for d5edda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5edda2